PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00101.1_g00047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 264aa    MW: 30344.8 Da    PI: 9.1365
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00101.1_g00047.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding444.9e-141663148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEde+l   +  +G  +W+t++ + g+ R +k+c++rw +yl
  Rsa1.0_00101.1_g00047.1 16 KGFWSPEEDEKLRSFILSHGHSCWTTVPIKAGLQRNGKSCRLRWINYL 63
                             688*******************************************97 PP

2Myb_DNA-binding41.92.3e-1374114648
                              HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +eE+e++ + +  lG++ W++Ia++++ gR ++++k++w+++l
  Rsa1.0_00101.1_g00047.1  74 AEEEEIIMNFHSSLGNK-WSRIAKYLP-GRADNEIKNYWHSHL 114
                              7****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.2361167IPR017930Myb domain
SuperFamilySSF466892.58E-2613110IPR009057Homeodomain-like
SMARTSM007171.3E-91565IPR001005SANT/Myb domain
PfamPF002491.4E-111763IPR001005SANT/Myb domain
CDDcd001671.48E-71963No hitNo description
Gene3DG3DSA:1.10.10.605.0E-201970IPR009057Homeodomain-like
PROSITE profilePS5129416.368118IPR017930Myb domain
SMARTSM007179.3E-1068116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2171117IPR009057Homeodomain-like
CDDcd001671.90E-773114No hitNo description
PfamPF002491.5E-1174114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MVKTKAGERP KQRQRKGFWS PEEDEKLRSF ILSHGHSCWT TVPIKAGLQR NGKSCRLRWI  60
NYLRPGLKRD MINAEEEEII MNFHSSLGNK WSRIAKYLPG RADNEIKNYW HSHLKKRWLK  120
SQRLQHATSS MSTSSESLVA CGKRNPKTLI SSHVISFQTP PEKSPSSPSQ ESLDNNNKNN  180
YPCSSGPPEI PTLFFSEWFS SSDPHFDHSS DLTESNHNQT QTIQGPASDY EEAGDVNRFP  240
YNEMVMDNNS NWTLNDVVFG SKWQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-22161177107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137536.11e-162PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K41e-129LAF1_ARATH; Transcription factor LAF1
TrEMBLM4DRL11e-162M4DRL1_BRARP; Uncharacterized protein
STRINGBra019154.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-112myb domain protein 18